PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_12067A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 272aa    MW: 30623.9 Da    PI: 7.1341
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_12067AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.3e-191764148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WTt+Ed+ll+d v+q+G g+W+++ +  g++R++k+c++rw +yl
  Oropetium_20150105_12067A 17 KGPWTTQEDKLLIDHVRQHGEGRWNSVCKLTGLKRSGKSCRLRWVNYL 64
                               79********************************************97 PP

2Myb_DNA-binding51.62.2e-1670114147
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                rg+ T++E+ ++++++ ++G++ W+tIar ++ gRt++++k++w+++
  Oropetium_20150105_12067A  70 RGKITPQEENIIIQLHGLWGNR-WSTIARSLP-GRTDNEIKNYWRTH 114
                                8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0591264IPR017930Myb domain
SuperFamilySSF466893.29E-2915111IPR009057Homeodomain-like
SMARTSM007172.3E-151666IPR001005SANT/Myb domain
PfamPF002493.1E-171764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-231871IPR009057Homeodomain-like
CDDcd001671.31E-111964No hitNo description
PROSITE profilePS5129425.57465119IPR017930Myb domain
SMARTSM007171.3E-1569117IPR001005SANT/Myb domain
PfamPF002492.7E-1470114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-2472117IPR009057Homeodomain-like
CDDcd001671.62E-1074115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MEGQLSWGRQ EVDGWRKGPW TTQEDKLLID HVRQHGEGRW NSVCKLTGLK RSGKSCRLRW  60
VNYLRPDLKR GKITPQEENI IIQLHGLWGN RWSTIARSLP GRTDNEIKNY WRTHFKKGKP  120
SKNIERARAR FLKQRREMQS QQQQQQQLAV SKQDDENNNH DATRTADTDD DDRGSAVVDN  180
ATTAAADQSG HHHSHQNVDL IMQDDAMDFM CPMPCALLLH GGAGHHQTGA AGSYCGSTSE  240
ESSEENVGGT WGSLWNLDDV IVVDGGSCTL W*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-261711727126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096201e-123AK109620.1 Oryza sativa Japonica Group cDNA clone:002-138-A05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978126.11e-119PREDICTED: transcription repressor MYB6-like
TrEMBLK3Y9D01e-119K3Y9D0_SETIT; Uncharacterized protein
STRINGSi010822m1e-118(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.15e-64myb domain protein 79